1.67 Rating by CuteStat

saintjeromecenter.com is 8 years 9 months old. It is a domain having com extension. It has a global traffic rank of #15629760 in the world. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, saintjeromecenter.com is SAFE to browse.

PageSpeed Score
79
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: 31
Daily Pageviews: 62

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 15,629,760
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

192.0.78.24

Hosted Country:

United States of America US

Location Latitude:

37.7506

Location Longitude:

-122.4121
Catholic, Orthodox, Free | An Online Source for Catholic Catechesis

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: 1
H3 Headings: 4 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: 1 Total Images: 4
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 192.0.78.24)

Akismet – Spam Protection for Websites

- akismet.com

Say goodbye to spam with Akismet – the ultimate spam protection used by millions of websites. Sign up today and never worry about spam again!

15,784 $ 1,131,840.00

ThemeShaper – Shaping WordPress Themes

- themeshaper.com

Shaping WordPress Themes

395,246 $ 22,680.00

PostSecret

- postsecret.com
110,561 $ 108,600.00

arturogoga – tecnología para todos

- arturogoga.com

tecnología para todos

267,116 $ 33,480.00

@BizOrlandoFL Consultancy | Editing, Writing, Social Media Promotions

- bizorlando.com

SOS Local at BizOrlando.com = Entrepreneur Initiatives and Solutions for Local Business by Kathryn McHenry / Editing, Writing, Promotions, Digital Marketing

Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Server: nginx
Date: Fri, 31 Jul 2015 08:18:13 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Cookie
X-hacker: If you're reading this, you should visit automattic.com/jobs and apply to join the fun, mention this header.
X-Pingback: http://saintjeromecenter.com/xmlrpc.php
Link: <http://wp.me/P6vriV-7>; rel=shortlink
Last-Modified: Fri, 31 Jul 2015 08:18:12 GMT
Cache-Control: max-age=300, must-revalidate
X-nananana: Batcache
Content-Encoding: gzip
X-ac: 3.dca _dca

Domain Information

Domain Registrar: Camelot 42 888, LLC
Registration Date: Jul 24, 2015, 12:00 AM 8 years 9 months 2 weeks ago
Last Modified: Jul 24, 2015, 12:00 AM 8 years 9 months 2 weeks ago
Expiration Date: Jul 24, 2016, 12:00 AM 7 years 9 months 2 weeks ago
Domain Status:
clientDeleteProhibited
clientRenewProhibited
clientTransferProhibited
clientUpdateProhibited

Domain Nameserver Information

Host IP Address Country
ns1.wordpress.com 198.181.116.9 United States of America United States of America
ns2.wordpress.com 198.181.117.9 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
saintjeromecenter.com A 299 IP: 192.0.78.24
saintjeromecenter.com A 299 IP: 192.0.78.25
saintjeromecenter.com NS 21599 Target: ns1.wordpress.com
saintjeromecenter.com NS 21599 Target: ns2.wordpress.com
saintjeromecenter.com NS 21599 Target: ns3.wordpress.com
saintjeromecenter.com SOA 21599 MNAME: ns1.wordpress.com
RNAME: hostmaster.wordpress.com
Serial: 2005071858
Refresh: 14400
Retry: 7200
Expire: 604800
Minimum TTL: 300

Similarly Ranked Websites

yaptatadiyamankervansaraykahve.net | Isimtescil.net | Ücretsiz yapım a

- yaptatadiyamankervansaraykahve.net
15,629,791 $ 8.95

nanex.exchange - Registered at Namecheap.com

- nanex.exchange
15,629,834 $ 8.95

herranetxecasarural.com - Registered at Namecheap.com

- herranetxecasarural.com
15,629,844 $ 8.95

fullkontor.biz, Parça Kontör, Turkcell, Vodafone, Avea,

- fullkontor.biz

fullkontor.biz, PARÇA KONTÖR DÄ°STRÄ°BÃœTÖRLÃœÄ

15,629,863 $ 8.95

Galop Canal Bluegrass Festival | Join us June 12th-15th at the Iroquoi

- galopcanalbluegrass.ca

Join us June 12th-15th, 2014 at the Iroquois Locks for the 4th Annual Galop Canal Bluegrass Festival.

15,629,868 $ 8.95

Full WHOIS Lookup

Domain Name: SAINTJEROMECENTER.COM
Registrar URL: http://www.wildwestdomains.com
Registrant Name: Michael Lofton
Registrant Organization: St. Jerome Center
Name Server: NS1.WORDPRESS.COM
Name Server: NS2.WORDPRESS.COM
DNSSEC: unsigned

For complete domain details go to:
http://who.securepaynet.net/whoischeck.aspx?domain=SAINTJEROMECENTER.COM&prog_id=391143

The data contained in this Registrar's Whois database,
while believed by the registrar to be reliable, is provided "as is"
with no guarantee or warranties regarding its accuracy. This information
is provided for the sole purpose of assisting you in obtaining
information about domain name registration records. Any use of
this data for any other purpose is expressly forbidden without
the prior written permission of this registrar. By submitting an
inquiry, you agree to these terms of usage and limitations of warranty.
In particular, you agree not to use this data to allow, enable, or
otherwise make possible, dissemination or collection of this data, in
part or in its entirety, for any purpose, such as the transmission of
unsolicited advertising and solicitations of any kind, including spam.
You further agree not to use this data to enable high volume, automated
or robotic electronic processes designed to collect or compile this data
for any purpose, including mining this data for your own personal or
commercial purposes.

Please note: the owner of the domain name is specified in the "registrant" section.
In most cases, the Registrar is not the owner of domain names listed in this database.