Web Analysis for Saintjeromecenter - saintjeromecenter.com
saintjeromecenter.com is 8 years 9 months old. It is a domain having com extension. It has a global traffic rank of #15629760 in the world. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, saintjeromecenter.com is SAFE to browse.
PageSpeed Score
Siteadvisor Rating
Traffic Report
Daily Unique Visitors: | 31 |
Daily Pageviews: | 62 |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | 15,629,760 |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 1 | H2 Headings: | 1 |
H3 Headings: | 4 | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | 1 | Total Images: | 4 |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 192.0.78.24)
Akismet – Spam Protection for Websites
Say goodbye to spam with Akismet – the ultimate spam protection used by millions of websites. Sign up today and never worry about spam again!
ThemeShaper – Shaping WordPress Themes
Shaping WordPress Themes
@BizOrlandoFL Consultancy | Editing, Writing, Social Media Promotions
SOS Local at BizOrlando.com = Entrepreneur Initiatives and Solutions for Local Business by Kathryn McHenry / Editing, Writing, Promotions, Digital Marketing
HTTP Header Analysis
Server: nginx
Date: Fri, 31 Jul 2015 08:18:13 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Cookie
X-hacker: If you're reading this, you should visit automattic.com/jobs and apply to join the fun, mention this header.
X-Pingback: http://saintjeromecenter.com/xmlrpc.php
Link: <http://wp.me/P6vriV-7>; rel=shortlink
Last-Modified: Fri, 31 Jul 2015 08:18:12 GMT
Cache-Control: max-age=300, must-revalidate
X-nananana: Batcache
Content-Encoding: gzip
X-ac: 3.dca _dca
Domain Information
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
ns1.wordpress.com | 198.181.116.9 | United States of America | |
ns2.wordpress.com | 198.181.117.9 | United States of America |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
saintjeromecenter.com | A | 299 |
IP: 192.0.78.24 |
saintjeromecenter.com | A | 299 |
IP: 192.0.78.25 |
saintjeromecenter.com | NS | 21599 |
Target: ns1.wordpress.com |
saintjeromecenter.com | NS | 21599 |
Target: ns2.wordpress.com |
saintjeromecenter.com | NS | 21599 |
Target: ns3.wordpress.com |
saintjeromecenter.com | SOA | 21599 |
MNAME: ns1.wordpress.com RNAME: hostmaster.wordpress.com Serial: 2005071858 Refresh: 14400 Retry: 7200 Expire: 604800 Minimum TTL: 300 |
Similarly Ranked Websites
yaptatadiyamankervansaraykahve.net | Isimtescil.net | Ücretsiz yapım a
fullkontor.biz, Parça Kontör, Turkcell, Vodafone, Avea,
fullkontor.biz, PARÇA KONTÖR DÄ°STRÄ°BÃœTÖRLÃœÄ
Galop Canal Bluegrass Festival | Join us June 12th-15th at the Iroquoi
Join us June 12th-15th, 2014 at the Iroquois Locks for the 4th Annual Galop Canal Bluegrass Festival.
Full WHOIS Lookup
Registrar URL: http://www.wildwestdomains.com
Registrant Name: Michael Lofton
Registrant Organization: St. Jerome Center
Name Server: NS1.WORDPRESS.COM
Name Server: NS2.WORDPRESS.COM
DNSSEC: unsigned
For complete domain details go to:
http://who.securepaynet.net/whoischeck.aspx?domain=SAINTJEROMECENTER.COM&prog_id=391143
The data contained in this Registrar's Whois database,
while believed by the registrar to be reliable, is provided "as is"
with no guarantee or warranties regarding its accuracy. This information
is provided for the sole purpose of assisting you in obtaining
information about domain name registration records. Any use of
this data for any other purpose is expressly forbidden without
the prior written permission of this registrar. By submitting an
inquiry, you agree to these terms of usage and limitations of warranty.
In particular, you agree not to use this data to allow, enable, or
otherwise make possible, dissemination or collection of this data, in
part or in its entirety, for any purpose, such as the transmission of
unsolicited advertising and solicitations of any kind, including spam.
You further agree not to use this data to enable high volume, automated
or robotic electronic processes designed to collect or compile this data
for any purpose, including mining this data for your own personal or
commercial purposes.
Please note: the owner of the domain name is specified in the "registrant" section.
In most cases, the Registrar is not the owner of domain names listed in this database.